May associate with CadN and participate in the transmission of developmental information. Can associate with alpha-catenin. Accumulates through wg signaling; arm function in wg signal transduction is required early in development for determination of neuroblast fate. Arm and Abl proteins function cooperatively at adherens junctions in both the CNS and epidermis (By similarity).

Belongs to the beta-catenin family.

832 amino acids

MSYQMPQNRTMSHNPYNSSDMPMPSAKEQTLMWQQNSYLGDSGIHSGAVTQVPSLSGKDDDMEDDPLMFDMDQGFSQNFTQDQVDDMNQQLSQTRSQRVRAAMFPETLEEGIEIPSTQFDPQQPTAVQRLSEPSQMLKHAVVNLINYQDDADLATRAIPELIKLLNDEDQVVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRALSQSNDLETTKGAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVALLQRNNVKFLAIVTDCLQILAYGNQESKLIILASTGPSELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALAMHLGNPSQRLVQNCLWTLRNLSDAATKVDGLETLLSGLVTVLGSSDVNVVTCAAGILSNLTCNNQRNKVTVCQVGGVEALVGTIINAGDREEITEPAVCALRHLTSRHPESESAQNIVRNGYGLPVIVKLLNPPSRWPLIKAVIGLIRNLALCPSNAAPLREHGAIHLLVRLLFKAFQDTQRQRSSVATNGSQPPGAYADGVRMEEIVEGTVGALHILSKEELNRQLIRQQNVISIFVQLLFYNDIENIQRVAAGVLCELAVDKEVAEMIEAEGATAPLTELLNSANEGVATYAAAVLFKMSEDKSMDYKKRFSSELTTLPVFRDDTMWNNGELGIGPDLQDILSPDQAYEGLYGQGPPSVHSSHGGRAFQQGYDTLPIDSMQGLEIGGGGNAGPAGSNPNAGNNPGAGGPPSGQPTSPYAMDMDVGEMDASELTFDHLDVMPSPPQDNNQVAAWYDTDL

90.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make arm using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here