Description
May associate with CadN and participate in the transmission of developmental information. Can associate with alpha-catenin. Accumulates through wg signaling; arm function in wg signal transduction is required early in development for determination of neuroblast fate. Arm and Abl proteins function cooperatively at adherens junctions in both the CNS and epidermis (By similarity).
Family
Belongs to the beta-catenin family.
Sequence
MSYQMPQNRTMSHNPYNSSDMPMPSAKEQTLMWQQNSYLGDSGIHSGAVTQVPSLSGKDDDMEDDPLMFDMDQGFSQNFTQDQVDDMNQQLSQTRSQRVRAAMFPETLEEGIEIPSTQFDPQQPTAVQRLSEPSQMLKHAVVNLINYQDDADLATRAIPELIKLLNDEDQVVVSQAAMMVHQLSKKEASRHAIMNSPQMVAALVRALSQSNDLETTKGAVGTLHNLSHHRQGLLAIFKSGGIPALVKLLSSPVESVLFYAITTLHNLLLHQDGSKMAVRLAGGLQKMVALLQRNNVKFLAIVTDCLQILAYGNQESKLIILASTGPSELVRIMRSYDYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALAMHLGNPSQRLVQNCLWTLRNLSDAATKVDGLETLLSGLVTVLGSSDVNVVTCAAGILSNLTCNNQRNKVTVCQVGGVEALVGTIINAGDREEITEPAVCALRHLTSRHPESESAQNIVRNGYGLPVIVKLLNPPSRWPLIKAVIGLIRNLALCPSNAAPLREHGAIHLLVRLLFKAFQDTQRQRSSVATNGSQPPGAYADGVRMEEIVEGTVGALHILSKEELNRQLIRQQNVISIFVQLLFYNDIENIQRVAAGVLCELAVDKEVAEMIEAEGATAPLTELLNSANEGVATYAAAVLFKMSEDKSMDYKKRFSSELTTLPVFRDDTMWNNGELGIGPDLQDILSPDQAYEGLYGQGPPSVHSSHGGRAFQQGYDTLPIDSMQGLEIGGGGNAGPAGSNPNAGNNPGAGGPPSGQPTSPYAMDMDVGEMDASELTFDHLDVMPSPPQDNNQVAAWYDTDL
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service