Catalyzes two activities which are involved in the cyclic version of arginine biosynthesis: the synthesis of N-acetylglutamate from glutamate and acetyl-CoA as the acetyl donor, and of ornithine by transacetylation between N(2)-acetylornithine and glutamate.

Belongs to the ArgJ family.

408 amino acids

MMIKVASITKLENGSIVTPKGFSAIGTVNGLKKEKKDLGAIVCDVPASCAAVYTTNQIQAAPLQVTKDSITAEGKLQAIIVNSGNANACTGMQGLQDAYEMRVLGAEHFGMKENYVAVASTGVIGVPLPMDIIRKGVATLIPTKEESEAYSFSEAILTTDLITKETCYEMIIDGKKVVIAGVAKGSGMIHPNMATMLSFITTDAHIEHNVLQTALSQITNHTFNQITVDGDTSTNDMVIVMASGLSETRPINMEHTDWETFVGALQKVCEDLAKKIAQDGEGATKLIEVNVLGAQTNEEAKKIAKQIVGSSLVKTAIHGEDPNWGRIISSIGQSEVAINPNTIDITLQSISVLKNSEPQTFSEEKMKERLQEDEIVINVYLHLGEETGSAWGCDLSYEYVKINACYRT

44 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make argJ using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here