Description
May play a role in the regulation of extra-urea cycle arginine metabolism and also in down-regulation of nitric oxide synthesis. Extrahepatic arginase functions to regulate L-arginine bioavailability to nitric oxid synthase (NOS). Arginine metabolism is a critical regulator of innate and adaptive immune responses. Seems to be involved in negative regulation of the survival capacity of activated T cells. May suppress inflammation-related signaling in asthmatic airway epithelium. May play a role in promoting prenatal immune suppression. Regulates RPS6KB1 signaling, which promotes endothelial cell senescence and inflammation and implicates NOS3/eNOS dysfunction. Can inhibit endothelial autophagy independently of its enzymatic activity implicating mTORC2 signaling. Involved in vascular smooth muscle cell senescence and apoptosis independently of its enzymatic activity.
Family
Belongs to the arginase family.
Species
Oryctolagus cuniculus
Sequence
MSYGSCVSRLLRTRVQSVLKKSVHSVAVIGAPFSQGQKRKGVECGPAAIRDAGLVKRLSDLGCRLKDYGDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVNRAVSGGYSCVTVGGDHSLAIGTISGHARHCPDLCVVWVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVPQLPGFSWIKPCISSPSIVYIGLRDVDPPEHFILKKYDIQYFSMRDIDRLGIQKVMEQTFDLLIGKKQRPIHLSFDIDAFDPTLAPATGTPGCGGADLSRRMYISEEIHNTGLLSALDLVEVNPRLAASDEEAKATASLAVDVIASSFGQTREGGHTVYEQLPPPSSPHESENAERVRI
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service