Is responsible for the final step in the biosynthesis of archaeosine, a modified nucleoside present in the dihydrouridine loop (D-loop) of archaeal tRNA (PubMed:28383498, PubMed:22032275). Catalyzes the conversion of 7-cyano-7-deazaguanine (preQ0)-modified tRNA to archaeosine-tRNA, transforming a nitrile group to a formamidine group. Can use neither glutamine nor asparagine as amino donor in vitro, is only able to utilize free ammonium (PubMed:28383498). However, the enzyme might function in vivo with a partner that serves to generate ammonium.

Belongs to the archaeosine synthase type 2 family.

109 amino acids

MLKVSKSPSLVRLKTRGESVCPISKTVDSFEVSVEYIPRGAVLAIEEFKKMVDSYRGREILHEELAVDLLEKVKAAVNPPYVKVTVKSYYIGVEVEVVAESGGVPPVYI

12.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make queF-L using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here