About Products Protein Database Contact

Protein expression services for arcS | Archaeosine synthase

Description
Is responsible for the final step in the biosynthesis of archaeosine, a modified nucleoside present in the dihydrouridine loop (D-loop) of archaeal tRNA. Catalyzes the conversion of 7-cyano-7-deazaguanine (preQ0)-modified tRNA to archaeosine-tRNA, transforming a nitrile group to a formamidine group. Can use either glutamine, asparagine or ammonium as amino donor.
Family
Belongs to the archaeosine synthase type 1 family.
Species
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
Length
569 amino acids
Sequence
MLEPIAYDIGRLCKEEDKELTPKLIDIDVIGLSQEKIFYGIMTPFRCPNSKSIYELRKSYVKADGIKMPFDTFRELTSIFKKSFIGTVKYKGNVFKYQILNFGKHVDLIELEDADLYIIADGRRLIERKELQIIPKIREKISPNSAIYSPAVFPWEIPLLAYIGVDYFDDSLAKLYASMGYKFTKNRAVKVDSFSFEELYNNNKKVYEEILEEVRIAIKNGFLRNVVEETAVSHPYLWANYRRYEPDLRNIPLSKENKIIVTTNINIPEVKKYLERLDNYEPYSNIIVLLPCSSKKPYSISQSHQKFIKAIKSAKVVVEEVILTSPYGLVPRALERLVNYDIPVTGEWSFEEIELINNCLKNFLKKVKEKFDDYIVIAHLPEHYLEILELDDIVITSKGNPTSEEALKNLTDTLKKYKELTKSKDINKKGQRIHNIQQLAEFQFGINFIPNEIFINHKGQIFTKINNKNQQIASINPKNGLLILTLSGGELLWNSGGKDINYIEVNYEIKKGSLFPPGFVDCNENISYNDEVVLIKDDTFLGIGRALMSGFEMKKAKHGALVNIRNVKS
Mass
65.6 kDa
Simulated SDS-PAGE
Western blot of arcS recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make arcS using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here