Channel that permits osmotically driven movement of water in both directions. It is involved in the osmoregulation and in the maintenance of cell turgor during volume expansion in rapidly growing cells. It mediates rapid entry or exit of water in response to abrupt changes in osmolarity (By similarity).

Belongs to the MIP/aquaporin (TC 1.A.8) family.

241 amino acids

MSRKFISEFLGTFWLVFGGCGSAVFAAAFPELGIGFLGVAFAFGLTVLTMAYAVGGISGGHFNPAVSVGLTVAGKFPAANLVPYIVAQVLGAVVAAAALYVILTGKAGAEIGGFAANGYGEHSPGGYSLLSALLIEIILTAFFLVVILGSTHGRVPVGFAPVAIGLALTLIHLISIPVTNTSVNPARSTGQALFVGGWALQQLWLFWLAPILGGAIGAVVWKIFGEEEKAGHAGSVQPAKT

24.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make aqpZ1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here