Plays a major role in programmed cell death (PCD, apoptosis). egl-1 binds to and directly inhibits the activity of ced-9, releasing the cell death activator ced-4 from a ced-9/ced-4 containing protein complex and allowing ced-4 to activate the cell-killing caspase ced-3. During larval development, required for the elimination of transient presynaptic components downstream of egl-1 and upstream of ced-4 and ced-3 apoptotic pathway.

Belongs to the Bcl-2 family.

266 amino acids

MVDSMDMANSSQNTFRRRTMATSEMREFLSTKDAEPNNFGMQTIPESPTPSTPTRRMSIGDSTRIYDWEEPRFNIQGFVVDYFTYRIAQNGLDWYDAPALPDGVQKEHEMMRSLGTIFEKRHMEMFENFSEQLLAVPKISFSLYQEVVQTVGNSSNTPCPMSYGRLIGLISFGGMVAAKMMESAELQGQVRNLLMYTSLFIKTRIRQSWKEHNRSWADFMKLGQQMKEDYEKEKDAEEGKRLKSWSIIGASVIAVIVCGRIIFSFK

30.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ced-9 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here