Protein expression services for higA-1 | Antitoxin HigA-1
Description
Antitoxin component of a type II toxin-antitoxin (TA) system that counteracts the effect of the HigB-1 toxin. Binds to its own promoter and regulates transcription of the higB-1/higA-1 operon.
Species
Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Length
105 amino acids
Sequence
MRKTKRRPVSVGEMLKVEFLEPMGITSKALAEAMGVHRNTVSNLINGGVLTAPVAIKLAAALGNTPEFWLNIQHAVDLWDTRNRYQEEAKFVKPLFVSLEQSART
Mass
11.7 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make higA-1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here