Description
An anti-sigma factor for extracytoplasmic function (ECF) sigma factor SigM. ECF sigma factors are held in an inactive form by an anti-sigma factor until released by regulated intramembrane proteolysis (RIP). RIP occurs when an extracytoplasmic signal triggers a concerted proteolytic cascade to transmit information and elicit cellular responses. The membrane-spanning regulatory substrate protein is first cut extracytoplasmically (site-1 protease, S1P), then within the membrane itself (site-2 protease, S2P, Rip1), while cytoplasmic proteases finish degrading the regulatory protein, liberating the sigma factor (By similarity).
Species
Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Sequence
MSAADKDPDKHSADADPPLTVELLADLQAGLLDDATAARIRSRVRSDPQAQQILRALNRVRRDVAAMGADPAWGPAARPAVVDSISAALRSARPNSSPGAAHAARPHVHPVRMIAGAAGLCAVATAIGVGAVVDAPPPAPSAPTTAQHITVSKPAPVIPLSRPQVLDLLHHTPDYGPPGGPLGDPSRRTSCLSGLGYPASTPVLGAQPIDIDARPAVLLVIPADTPDKLAVFAVAPHCSAADTGLLASTVVPRA
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service