An anti-sigma factor for extracytoplasmic function (ECF) sigma factor SigM. ECF sigma factors are held in an inactive form by an anti-sigma factor until released by regulated intramembrane proteolysis (RIP). RIP occurs when an extracytoplasmic signal triggers a concerted proteolytic cascade to transmit information and elicit cellular responses. The membrane-spanning regulatory substrate protein is first cut extracytoplasmically (site-1 protease, S1P), then within the membrane itself (site-2 protease, S2P, Rip1), while cytoplasmic proteases finish degrading the regulatory protein, liberating the sigma factor (By similarity).

254 amino acids

MSAADKDPDKHSADADPPLTVELLADLQAGLLDDATAARIRSRVRSDPQAQQILRALNRVRRDVAAMGADPAWGPAARPAVVDSISAALRSARPNSSPGAAHAARPHVHPVRMIAGAAGLCAVATAIGVGAVVDAPPPAPSAPTTAQHITVSKPAPVIPLSRPQVLDLLHHTPDYGPPGGPLGDPSRRTSCLSGLGYPASTPVLGAQPIDIDARPAVLLVIPADTPDKLAVFAVAPHCSAADTGLLASTVVPRA

25.8 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make rsmA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here