Inhibits RpoS proteolysis by regulating RssB activity, thereby increasing the stability of the sigma stress factor RpoS during magnesium starvation.

Belongs to the IraM/RssC family.

107 amino acids

MKWIVIDTIIQPSCGISFSAIWGNMKMIIWYQSTIFLPPGSIFTPVKSGIILKDKEYPITIYNIAPFNKDLWSLLKSSQECPPGESKITNKCLHNSCIIKICPYGLK

12.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make iraM using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here