This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade.

Belongs to the annexin family.

327 amino acids

MAWWKAWVEQEGVSVKGSSHFNPDPDAETLYKAMKGIGTNEQAIIDVLTKRSNVQRQQIAKSFKAQFGKDLTETLKSELSGKFERLIVALMYPPYRYEAKELHDAMKGLGTKEGVIIEILASRTKNQLREIMKAYEEDYGSTLEEDIQGDTSGYLERILVCLLQGCRDDVSGFVDPGLALQDAQDLHAAGEKILGTDEMKFITILCTRSATHLMRVFEEYEKIANKSIEDSIKSETHGSLEEAMLTVVKCTRNVHSYFAERLYYAMKGAGTLDGTLIRNIVSRSEIDLNLIKSQFQKMYGKTLSSMIMGDTSGYYKTALLNLVGTDL

36.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Anxa8 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here