Exhibits chaperone activity toward chloroplast outer envelope membrane, mitochondrion outer membrane, endoplasmic reticulum membrane and peroxisomal proteins, by recruiting specific proteins containing a single transmembrane associated with an AKR2A-binding sequence (ABS) and subsequently binding glycolipids (e.g. monogalactosyldiacylglycerol (MGDG) and phosphatidylglycerol (PG)) present in the membrane of the target organelle (PubMed:18193034, PubMed:20215589, PubMed:25203210). Seems to be involved in the regulation of hydrogen peroxide levels during biotic and abiotic stresses by optimizing the ascorbate peroxidase 3 (APX3) hydrogen peroxide-degrading activity. This regulation might be monitored by GRF6. Cytosolic targeting factor for chloroplast outer membrane (COM) proteins that mediates sorting and targeting of nascent chloroplast outer envelope membrane (OEM) proteins to the chloroplast. Facilitates the targeting of OEP7 to chloroplasts (PubMed:18193034). Facilitates the targeting of APX3 to peroxisomes. Involved in cellular metabolism (e.g. peroxisome activity) and required for plant growth and development (PubMed:20215589).

342 amino acids

MASNSEKNPLLSDEKPKSTEENKSSKPESASGSSTSSAMPGLNFNAFDFSNMASILNDPSIREMAEQIAKDPAFNQLAEQLQRSIPNAGQEGGFPNFDPQQYVNTMQQVMHNPEFKTMAEKLGTALVQDPQMSPFLDAFSNPETAEHFTERMARMKEDPELKPILDEIDAGGPSAMMKYWNDPEVLKKLGEAMGMPVAGLPDQTVSAEPEVAEEGEEEESIVHQTASLGDVEGLKAALASGGNKDEEDSEGRTALHFACGYGELKCAQVLIDAGASVNAVDKNKNTPLHYAAGYGRKECVSLLLENGAAVTLQNLDEKTPIDVAKLNSQLEVVKLLEKDAFL

37 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make AKR2A using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here