About Products Protein Database Contact

Protein expression services for anmK | Anhydro-N-acetylmuramic acid kinase

Description
Catalyzes the specific phosphorylation of 1,6-anhydro-N-acetylmuramic acid (anhMurNAc) with the simultaneous cleavage of the 1,6-anhydro ring, generating MurNAc-6-P. Is required for the utilization of anhMurNAc either imported from the medium or derived from its own cell wall murein, and thus plays a role in cell wall recycling.
Family
Belongs to the anhydro-N-acetylmuramic acid kinase family.
Species
Nitrosococcus oceani (strain ATCC 19707 / BCRC 17464 / NCIMB 11848 / C-107)
Length
376 amino acids
Sequence
MAQRYIGLLSGTSMDAVDAALVELEPLRILATHSIPISLALRQQLFAVIERSTTSLGELGALDIRLGRLFAETALELLAKAKCSVTEVQAIGSHGQTIYHWARGPDPFTLQLADPNTIAEITGITTIADFRRRDLAAGGQGAPLAPAFHAAFLRSPHYHRAVLNIGGIANISFLPADHRTPIWGFDTGPGNTLMDGWISRHLNQSIDREGRWAASGRVNKTLLRYLLTDPYFSLPPPKSTGREYFNLVWLDHILSKTGIKLSPPDVQATLCALTIASVKLAIQSSSPHTEELLICGGGANNETLMEGLRKQLAFCRVTTTTAYGIPPQWVEACTFAWLAKQTLEGHPGNLPEVTGARHPVILGAIYPANAAVSSRT
Mass
40.7 kDa
Simulated SDS-PAGE
Western blot of anmK recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make anmK using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here