Angiotensin 1-7: is a ligand for the G-protein coupled receptor MAS1. Has vasodilator and antidiuretic effects. Has an antithrombotic effect that involves MAS1-mediated release of nitric oxide from platelets.

Belongs to the serpin family.

486 amino acids

MQKRVPQSEMPPASMSLRVTILCLLAWAGLAAGDRVYIHPFHLVIHNESTCEELAKANAGKPEDPTFTPALIQAKSLPVDEKALQDQLVLVAAKLNAEDKLRAATVGMLANFLSFHIYSMHSELWGMVQGATILSPMAVFGTLASLYLGASNHTAYRLQAILGVPWKDENCTSRLDAHKVLSALQAVQGLLVAQDRAEGQTQLLLSTVVGLFTAPGLHLKQPFVQGLALYAPAVLPRSLDFSTDLDVAAEKIDRFMQAVTGWKVSSPLTGASADSNLVFNTYVHFQGKMKGFSLLAEPQEFWVDNSTSVSVPMLSGMGTFQHWSDAQDKFSVTQVPFTESACLLLIQPHYASDLDKVEGLTFQQNSLNWMNKLSPRAIHLTMPRLVLRGSYDLQDLLAQAELPTILGTELNLQKMSNNNLRVGKVLNSIFFELEADEKEPTESTQQPKGPEVLELNLNHPFLFAVYDQDATALYFLGRVANPLTTV

53.4 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make AGT using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here