Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle.

Belongs to the APC15 family.

120 amino acids

MSTLFPSLFPQVTDSLWFNLDRPCVDENELQQQEQQHQAWLLSIAEKDTGLVPIGKPASEPYDEEEEEDDEDDEDSEEDSEDDEDMQDMDEMNDYNESPDDGEIEADMEGAEQDQDQWMI

13.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make anapc15-a using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here