Description
Component of the cytosolic iron-sulfur (Fe-S) protein assembly (CIA) machinery. Required for the maturation of extramitochondrial Fe-S proteins. Part of an electron transfer chain functioning in an early step of cytosolic Fe-S biogenesis, facilitating the de novo assembly of a [4Fe-4S] cluster on the cytosolic Fe-S scaffold complex. Electrons are transferred from NADPH via a FAD- and FMN-containing diflavin oxidoreductase. Together with the diflavin oxidoreductase, also required for the assembly of the diferric tyrosyl radical cofactor of ribonucleotide reductase (RNR), probably by providing electrons for reduction during radical cofactor maturation in the catalytic small subunit.
Family
Belongs to the anamorsin family.
Species
Caenorhabditis briggsae
Sequence
MSAALSDFLKQSNLLQVTDGGPLVAGTDGVEGTRVDLVGEVEHAIIQVQETELLAEVCNTVFDVMKQNGEVLVFSTDLTTAHRKLRIAGFRVTELAADWPARGVKSVNFGDKVTLDLGNATVEEDLIDEDGLLQEEDYEKPTGDQLKAGGCGPDDPNKKKRACKNCNCGLAEQEEAEKMGKIAEASAAKSSCGNCALGDAFRCATCPYLGQPPFKPGETVKLSSVDDF
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service