About Products Protein Database Contact

Protein expression services for GSPATT00007825001 | Anamorsin homolog 2

Description
Component of the cytosolic iron-sulfur (Fe-S) protein assembly (CIA) machinery. Required for the maturation of extramitochondrial Fe-S proteins. Part of an electron transfer chain functioning in an early step of cytosolic Fe-S biogenesis, facilitating the de novo assembly of a [4Fe-4S] cluster on the cytosolic Fe-S scaffold complex. Electrons are transferred from NADPH via a FAD- and FMN-containing diflavin oxidoreductase. Together with the diflavin oxidoreductase, also required for the assembly of the diferric tyrosyl radical cofactor of ribonucleotide reductase (RNR), probably by providing electrons for reduction during radical cofactor maturation in the catalytic small subunit.
Family
Belongs to the anamorsin family.
Species
Paramecium tetraurelia
Length
250 amino acids
Sequence
MNLKITINQQASISEKLIIANLEQLLIFRDNTFNKIDCDQQITLKDAVQISQILNDQGVLNYEGEINEQITTYLEACGLYSQGQGQFIKRTLQTKKINIPQQDFNNCYGKYDYIEQKFQNQINFFKQVDLKGNQETIDENELLNDGVEVKQVESCASKPRACANCTCGRKEMEEKQDKEQLLEQLKNNSVKGCGSCYLGDAFRCANCPFRGLPAFKDGEQVKVLQDDVFLKEKEETDQIKLENGKVKLMI
Mass
28.6 kDa
Simulated SDS-PAGE
Western blot of GSPATT00007825001 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make GSPATT00007825001 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here