Part of the ammonia monooxygenase complex, which catalyzes the oxidation of ammonia to hydroxylamine, the first reaction in the process of ammonia oxidation to nitrite.

276 amino acids

MSIFRTEEILKAAKMPPEAVHMSRLIDAVYFPILIILLVGTYHMHFMLLAGDWDFWMDWKDRQWWPVVTPIVGITYCSAIMYYLWVNYRQPFGATLCVVCLLIGEWLTRYWGFYWWSHYPINFVTPGIMLPGALMLDFTLYLTRNWLVTALVGGGFFGLLFYPGNWPIFGPTHLPIVVEGTLLSMADYMGHLYVRTGTPEYVRHIEQGSLRTFGGHTTVIAAFFSAFVSMLMFTVWWYLGKVYCTAFFYVKGKRGRIVHRNDVTAFGEEGFPEGIK

32 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make amoA1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here