Catalyzes the deamination of aminodeoxyfutalosine (AFL) into futalosine (FL), a step in the biosynthesis of menaquinone (MK, vitamin K2). Is very poorly efficient on 1-(6-amino-9H-purin-9-yl)-1-deoxy-N-ethyl-beta-D-ribofuranuronamide (NECA), adenosine, 5'-methylthioadenosine, 5'-deoxyadenosine, 2'-deoxyadenosine, and AMP as substrate.

Belongs to the metallo-dependent hydrolases superfamily. Adenosine and AMP deaminases family.

356 amino acids

MTPHDPVSVEAVPKIELHVHLEGTVEPATVLDIAARNGLALPVSTVDELSALYRVTTFSDFLRLWILTTNVLRKAEDFSQVVVDYARRAKRHGAVYIEGIFSPVERVMRGVGWAEIFDGYCEGAERAYAEHGVVVRLTPEAYRGADPELVAEMVRYAGRYRDRGVVGVGIGGDERARPTRHYAAAFAPAVDLGLGVVPHAGEFPLFPDGASGAATLRETIEALNPVRIRHGIAAAADPALVAVIRERGIVLDVCPTSNLRTGAIRDLADHPLPRLAAAGIPCTVGTDDPAVFDTDLSREFTIAARLGVEPRLLYDAGITGALCDDDVKSHLRQIGAATTWPTTTATWSTTAAGESL

38.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Acel_0264 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here