About Products Protein Database Contact

Protein expression services for AIMP2 | Aminoacyl tRNA synthase complex-interacting multifunctional protein 2

Description
Required for assembly and stability of the aminoacyl-tRNA synthase complex. Mediates ubiquitination and degradation of FUBP1, a transcriptional activator of MYC, leading to MYC down-regulation which is required for aveolar type II cell differentiation. Blocks MDM2-mediated ubiquitination and degradation of p53/TP53. Functions as a proapoptotic factor.
Species
Bos taurus
Length
320 amino acids
Sequence
MPMYQVKPYHEGSGSLRVELPTCMYRLPNVHGRTGSPAPSADHVQEASDPSLQALESHQDDILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPAALSTSTVDLNAMLGQDHGALKDIVINANPASPPLSLLVLHRLLCDHYKVLSSVHTHSAVRSVPANLLQCFGEQTRQQPRHEYQLGFTLIWKDVPKTQMKFSVQTMCPIEGEGNIARFLFSLFGQKQDAVNLTLIDSWVDIAIFQLKEGSSKEKAAVFRSMNSALGKTPWLVGDELTVADVVLWSVLRQTGGCGGMAPANVQKWMQACENLAPFHTALKLLQ
Mass
35.2 kDa
Simulated SDS-PAGE
Western blot of AIMP2 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make AIMP2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here