Amino acid-proton symporter. Stereospecific transporter with a broad specificity for glutamate and both neutral and basic amino acids. Reduced affinities for asparagine and valine. High affinity transport of the cationic amino acids arginine and lysine, but not of histidine.

Belongs to the amino acid/polyamine transporter 2 family. Amino acid/auxin permease (AAAP) (TC 2.A.18.2) subfamily.

480 amino acids

MVVQNVQDLDVLPKHSSDSFDDDGRPKRTGTVWTASAHIITAVIGSGVLSLAWAVAQIGWIGGPVAMLLFSFVTFYTSTLLCSCYRSGDSVTGKRNYTYMDAIHSNLGGIKVKVCGVVQYVNLFGTAIGYTIASAISLVAIQRTSCQQMNGPNDPCHVNGNVYMIAFGIVQIIFSQIPDFDQLWWLSIVAAVMSFAYSAIGLGLGVSKVVENKEIKGSLTGVTVGTVTLSGTVTSSQKIWRTFQSLGNIAFAYSYSMILIEIQDTVKSPPAEVNTMRKATFVSVAVTTVFYMLCGCVGYAAFGDNAPGNLLAHGGFRNPYWLLDIANLAIVIHLVGAYQVYCQPLFAFVEKEASRRFPESEFVTKEIKIQLFPGKPFNLNLFRLVWRTFFVMTTTLISMLMPFFNDVVGLLGAIGFWPLTVYFPVEMYIAQKNVPRWGTKWVCLQVLSVTCLFVSVAAAAGSVIGIVSDLKVYKPFQSEF

52.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make AAP5 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here