Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the N-sulfonation of amines.

Belongs to the sulfotransferase 1 family.

293 amino acids

MDNKDEYLLNFKGYNFQKTLVKMEVVENIENYEIRDDDIFIVTYPKSGTIWTQQILSLIYFEGHRNRTENIETIDRAPFFEYNIHKLDYAKMPSPRIFSSHIPYYLVPKGLKDKKAKILYMYRNPKDVLISYFHFSNLMLIFQNPDTVESFMQTFLDGDVVGSLWFDHIRGWYEHRHDFNIMFMSFEDMKKDFRSSVLKICSFLEKELSEEDVDAVVRQATFQKMKADPRANYEHIIKDELGTRNEMGSFLRKGVVGAWKHYLTVDQSERFDKIFHRNMKNIPLKFIWDINEE

35.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Sult3a1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here