Rescues ribosomes stalled at the 3' end of non-stop mRNAs. Recruits release factor 2 (RF2) to the stalled ribosome, helping position it correctly in the ribosomal A site so its GGQ motif can hydrolyze the peptidyl-tRNA bond (By similarity).

Belongs to the alternative ribosome-rescue factor A family.

69 amino acids

MRKKQKSAVENETVYLHTRGVIKDNAVMALLGDKLFRQRVEKKRKGKGSYQRKAKHPGKIFEKPDYKFF

8.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make arfA using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here