About Products Protein Database Contact

Protein expression services for fc-dox | Alpha-ketoglutarate-dependent dioxygenase fc-dox

Description
Alpha-ketoglutarate-dependent dioxygenase; part of the 2 gene clusters that mediate the biosynthesis of fusicoccins, diterpene glucosides that display phytohormone-like activity and function as potent activators of plasma membrane H(+)-ATPases in plants by modifying 14-3-3 proteins and cause the plant disease constriction canker (PubMed:21299202, PubMed:22870285). The first step in the pathway is performed by the fusicoccadiene synthase PaFS that possesses both prenyl transferase and terpene cyclase activity, converting isopentenyl diphosphate and dimethylallyl diphosphate into geranylgeranyl diphosphate (GGDP) and successively converting GGDP into fusicocca-2,10(14)-diene, a precursor for fusicoccin H (PubMed:17360612). The second step is the oxidation at the C-8 position by the cytochrome P450 monooxygenase PaP450-2 to yield fusicocca-2,10(14)-diene-8-beta-ol (PubMed:22870285). The cytochrome P450 monooxygenase PaP450-1 then catalyzes the hydroxylation at the C-16 position to produce fusicocca-2,10(14)-diene-8-beta,16-diol (PubMed:22870285). The dioxygenase fc-dox then catalyzes the 16-oxydation of fusicocca-2,10(14)-diene-8-beta,16-diol to yield an aldehyde (8-beta-hydroxyfusicocca-1,10(14)-dien-16-al) (PubMed:21299202, PubMed:22870285). The short-chain dehydrogenase/reductase fc-sdr catalyzes the reduction of the aldehyde to yield fusicocca-1,10(14)-diene-8-beta,16-diol (PubMed:21299202, PubMed:22870285). The next step is the hydroxylation at C-9 performed by the cytochrome P450 monooxagenase PaP450-3 that leads to fusicoccin H aglycon which is glycosylated to fusicoccin H by the O-glycosyltransferase PaGT (PubMed:22870285). Hydroxylation at C-12 by the cytochrome P450 monooxygenase PaP450-4 leads then to the production of fusicoccin Q and is followed by methylation by the O-methyltransferase PaMT to yield fusicoccin P (PubMed:22870285). Fusicoccin P is further converted to fusicoccin J via prenylation by the O-glucose prenyltransferase PaPT (PubMed:22287087). Cytochrome P450 monooxygenase PaP450-5 then performs hydroxylation at C-19 to yield dideacetyl-fusicoccin A which is acetylated to 3'-O-deacetyl-fusicoccin A by the O-acetyltransferase PaAT-2 (PubMed:22870285). Finally, a another acetylation by the O-acetyltransferase PaAT-1 yields fusicoccin A (PubMed:22870285).
Family
Belongs to the TfdA dioxygenase family.
Species
Phomopsis amygdali
Length
399 amino acids
Sequence
MGSTAEDFVIKPMKGEHGFGAEIYGLDVNNITDEQVDRLRDTIQRYLLVVLKHQHDETPQKNWELLNRLSPDAPKFTPEEWALMYNPDPQGAGILPKLGYLVLPGTERLFLMGKGYQGEDHWGLKDIDIPEVFADAYYSKPLPHEDYHNGVARFQSWHIDGPSYKIDHPMFTSFRIIKFPEGEQTVDWADGSGLTKKVKAGRTAFFSSAKLYDMLTKEEQAIADYSWAEYMYFPYEWILRCRGNPQGLLVACEGREVPDEQMDAMPRNPEDQLVLPLVWVNPVTGGKHFHVQPNIVRRVFVRSGPDEEPKIIDDVKEVRDFFTKFQYRIIRPENIYVGPEEEGDQLLFFNWGVMHSKIDYPIEMGTRTTHQGWLAGDRPPKGPVPIPDPRARSSIYYQK
Mass
46 kDa
Simulated SDS-PAGE
Western blot of fc-dox recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make fc-dox using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here