Alpha/beta hydrolase; part of the gene cluster that mediates the biosynthesis of pseurotin A, a competitive inhibitor of chitin synthase and an inducer of nerve-cell proliferation (PubMed:24082142, PubMed:24939566). The PKS-NRPS hybrid synthetase psoA is responsible for the biosynthesis of azaspirene, one of the first intermediates having the 1-oxa-7-azaspiro[4,4]-non-2-ene-4,6-dione core of pseurotin, via condensation of one acetyl-CoA, 4 malonyl-CoA, and a L-phenylalanine molecule (PubMed:24082142, PubMed:24939566). The dual-functional monooxygenase/methyltransferase psoF seems to be involved in the addition of the C3 methyl group onto the pseurotin scaffold (PubMed:24939566). Azaspirene is then converted to synerazol through 4 steps including oxidation of C17 by the cytochrome P450 monooxygenase psoD, O-methylation of the hydroxy group of C8 by the methyltransferase psoC, and the trans-to-cis isomerization of the C13 olefin by the glutathione S-transferase psoE (PubMed:24939566). The fourth step of synerazol production is performed by the dual-functional monooxygenase/methyltransferase psoF which seems to catalyze the epoxidation of the intermediate deepoxy-synerazol (PubMed:24939566). Synerazol can be attacked by a water molecule nonenzymatically at two different positions to yield two diol products, pseurotin A and pseurotin D (PubMed:24939566).

Belongs to the UPF0255 family.

445 amino acids

MATIHKLFKSPFFDFEFLRLLAMAPYEGAEIGEVLEAAAKIKDQDPESWYSTLLETGGKAEAIAKQAEASGDRVGARRAYLRSSNYLRAAQFMLNEGPIGHDERVLPTLERAIANFRKGVQYRDGKTIFLEIPYEGGKTLPGYLYLPPAARRIPGRKIPILLNSGGGDSTQEEIYFVNPAYGPDLGYAVLTFEGPGQGIVLRRDKLPMRPDWESVTGPVLDHLFDLATRHPELELDLDHIAVTGASMGGYFALRAAADPRIKACVSVDGFYSLSSFVGGRMPGPLFNGFMSGWLSDWMFNGILGVLKKLAFQARWEFNHLRWATGSTTDADVMRSFGAYTLQKADGTEYLADVKCPTLVTGAGASFYFDPATTTDKIYDCLTSLQDGVDKEKWIATDVAYGGLQAKIGAFGYSAQKTFEWLDQRFGIQREPLAASSRLEDLVSRL

49.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make psoB using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here