Hydrolyzes alpha-1,2-linked fucose. Also active on fucosylated xyloglucan oligosaccharides.

Belongs to the 'GDSL' lipolytic enzyme family.

372 amino acids

MNPILSSLFALSLLSSLSPSTHAHQCHFPAIFNFGDSNSDTGGLSAAFGQAGPPHGSSFFGSPAGRYCDGRLVIDFIAESLGLPYLSAFLDSVGSNFSHGANFATAGSPIRALNSTLRQSGFSPFSLDVQFVQFYNFHNRSQTVRSRGGVYKTMLPESDSFSKALYTFDIGQNDLTAGYFANKTVEQVETEVPEIISQFMNAIKNIYGQGGRYFWIHNTGPIGCLAYVIERFPNKASDFDSHGCVSPLNHLAQQFNHALKQAVIELRSSLSEAAITYVDVYSLKHELFVHAQGHGFKGSLVSCCGHGGKYNYNKGIGCGMKKIVKGKEVYIGKPCDEPDKAVVWDGVHFTQAANKFIFDKIAPGLSKACKRQ

40.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make FXG1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here