Alpha-2 adrenergic receptors mediate the catecholamine-induced inhibition of adenylate cyclase through the action of G proteins. The order of potency for this receptor is norepinephrine > epinephrine.

Belongs to the G-protein coupled receptor 1 family. Adrenergic receptor subfamily. ADRA2B sub-subfamily.

510 amino acids

MDSPCPVAVGLPGHTNGTGGTSSPTCNQSMIKLAPYSPEATAAFATAITLMMLITIVGNILVIIAVLTSRSLRGPQNLFLVSLAAADILVATLIIPFSLANELMGYWYFRSVWCEIYLALDVLFCTSSIVHLCAISLDRYMSISRAVTYGPKRTPKRIKCAILVVWLISAVISFPPLLSMNKNKGGGESGALPQCQLNDERWYILYSTIGSFFAPCLIMILVYMRIYQIAKQRTRCPPGEPRKEAPANATTPQHKIQNGRGDETPGTLQKKARPPTLAVSQVESVQQAANTPIANNLLQAPSTTLTPTTPCPSPSPSNSSEVAPSKSKEGKKEKKKKKNNKNKNKKEPDNNNGESMSSDSDTEQGGRGLEVPCTPTMTPSGIHSPATMQKYRDMIATAKGAKLVARKAKQDGTPNSARRKAMVNREKRFTFVLAVVIGVFVICWFPFFFSYSLQAVCPESCALPEPLFKFFFWIGYCNSCLNPVIYTIFNKDFRRAFKKILCKNTKGTFF

56 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make adra2b using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here