Protein expression services for OsI_13745 | Alpha N-terminal protein methyltransferase 1
Description
Alpha-N-methyltransferase that methylates the N-terminus of target proteins containing the N-terminal motif [Ala/Pro/Ser]-Pro-Lys when the initiator Met is cleaved. Specifically catalyzes mono-, di- or tri-methylation of exposed alpha-amino group of Ala or Ser residue in the [Ala/Ser]-Pro-Lys motif and mono- or di-methylation of Pro in the Pro-Pro-Lys motif (By similarity).
Family
Belongs to the methyltransferase superfamily. NTM1 family.
Species
Oryza sativa subsp. indica
Length
307 amino acids
Sequence
MDSRGFDSEGREFSSATEMWAHEIGAAADAPVSAAVAEPAPAPAAGSNGVAGEQEAGGGGKREEWYSKAIAYWQGVEASTEGVLGGYGCVNDVDVKGSDAFLRPLLAERFGAARRHLVALDCGSGIGRVTKNFLLRHFNEVDLVEPVSHFLEAAQENLTECMEVGEDTHKAANFYCVPLQDFTPDEGRYDVIWIQWCIGQLPDDDFISFFNRAKIGLKPNGFFVLKENIARNGFVLDKEDNSITRSDAYFKELFKKCGLYIHSIKDQSDLPKELFAVKMYALVTEKPKIQKNGKRRRPKNSPRMIRS
Mass
34 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make OsI_13745 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here