Immunoglobulin-like receptor which plays an inhibitory role in degranulation of mast cells. Negatively regulates IgE-mediated mast cell activation and suppresses the type I immediate hypersensitivity reaction (By similarity).

248 amino acids

MGDDDTPVCLSVASCKGVSCWLDKLLLWALTLSITLRNTAVDCRRVDRNGLLSPNLNSSMSVVRMGQNVSLSCSSKNTSIDITYSLFLGKRYLESKRRRGGAVDFHLRISNANESGPYKCKVNDSNSSKYSQNFNFTIIQDESCSSCLLSLLLPGVLLGLILPGLAFLIYLKYKKGCTGKTLKENESKGSGDAPTQGELYANICETQKGSEQLQEIHYTTPVFKEVAPTEQEGLEDRKDDYIYSELTY

27.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Milr1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here