Protein expression services for Mip | Allatostatins MIP
Description
Ligand for the sex peptide receptor (SPR) (PubMed:20308537, PubMed:20458515, PubMed:25333796). Stabilizes sleep and maintains sleep homeostasis to inhibit the activity of wake-promoting circuits, such as those that involve the pigment dispersing factor (pdf) neurons. Regulated by the circadian clock network and pathways associated with a sleep homeostat (PubMed:25333796). May also have a regulatory role in gut motility (PubMed:11181081).
Species
Drosophila melanogaster
Length
211 amino acids
Sequence
MAHTKTRRTYGFLMVLLILGSACGNLVASGSAGSPPSNEPGGGGLSEQVVLDQLSESDLYGNNKRAWQSLQSSWGKRSSSGDVSDPDIYMTGHFVPLVITDGTNTIDWDTFERLASGQSAQQQQQQPLQQQSQSGEDFDDLAGEPDVEKRAWKSMNVAWGKRRQAQGWNKFRGAWGKREPTWNNLKGMWGKRDQWQKLHGGWGKRSQLPSN
Mass
23.4 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make Mip using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here