Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides.

Belongs to the peroxiredoxin family. AhpC/Prx1 subfamily.

189 amino acids

MSLINKEILPFTANAYDPQKDEFFEVSDENLKGSWSVVCFYPADFSFVCPTELEDLQGQYDKLQELGVNVYSVSTDTHFVHKAWHDHSDAISKIQYTMIGDPSQTITRNFDVLDEELGLAQRGTFIVDPDGVVQAAEVNADGIGRDASTLVHKIKAAQYVRQHPGEVCPAKWEEGSETLQPGLDLVGKI

21 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ahpC using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here