Catalyzes the hydroxylation of n-alkanes and fatty acids in the presence of a NADH-rubredoxin reductase and rubredoxin. It preferably hydroxylases C5-C12 hydrocarbons.

Belongs to the fatty acid desaturase type 1 family. AlkB subfamily.

404 amino acids

MSENILTEPPRSDADNEGYVDRKRHLWILSVLWPATPIIGLYLVSQTGWSIWYGLVLILWYGLVPLIDTMLGEDYSNPPESVVPKLEQDRYYKVLTYLTVPIHYAALIISAWWVSTQPIGVFEFLALALSLGIVNGLALNTGHELGHKKETFDRWMAKLVLAVVGYGHFFIEHNKGHHRDVATPMDPATSRMGESIYTFSLREIPGAFKRAWGLEEQRLSRCGKSVWSLDNEVLQPMILTVVLYAALLAFFGPLMLIFLPIQMAFGWWQLTSANYIEHYGLLREKLPNGRYEHQKPHHSWNSNHVMSNLILFHLQRHSDHHAHPTRSYQSLRDFSDLPTLPTGYPGMFFVAFFPSWFRSLMDDRVMEWAHGDINKIQIQPGMREFYEQKFGVKGSESPDTTVAK

46.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make alkB1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here