Catalyzes the depolymerization of alginate by cleaving the beta-1,4 glycosidic bond between two adjacent sugar residues via a beta-elimination mechanism. Degrades deacetylated polymannuronate alginate more efficiently than non-deacetylated polyM. Is able to degrade its own alginate, but at a lower efficiency than that produced from M.pyriferia and P.aeruginosa (PubMed:10049370). May serve to degrade mislocalized alginate that is trapped in the periplasmic space (By similarity).

Belongs to the polysaccharide lyase 5 family.

372 amino acids

MKTRLALPCLLGSLLLSSAVHAASALVPPKGYYAALEIRKGEAQACQAVPEPYTGELVFRSKYEGSDSARSTLNKKAEKAFRAKTKPITEIERGVSRMVMRYMEKGRLRRAGMRPGLLDAWAEDDALLSTEYNHTGKSMRKWALGSLAGAYLRLKFSTSQPLAAYPEQAKRIEAWFAKVGDQVIKDWSDLPLKQINNHSYWAAWSVMAAGVATNRRPLFDWAVEQFHIAAKQVDPRGFLANELKRRQRALAYHNYSLPPLMMIAAFAQANGVDLRGDNDGALGRLAGNVLAGVEDPEPFAERAGEDQDMEDLETDAKFSWLEPYCALYACSPALRERKAEMGPFKNFRLGGDVTRIFDPQEKPSKSTVGNAD

41.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make algL using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here