Plays two roles in the biosynthesis of the exopolysaccharide alginate: protects alginate from degradation as the polymer traverses the periplasm, and also plays a role in its O-acetylation. Probably has acetyltransferase activity in vivo (By similarity).

Belongs to the AlgX family.

485 amino acids

MTLMHPHMIKLLSLSGLTLGLLAASQGVRADEIKAPTFTAEPCCSLCPAAHDAKNYTTRYQQNFTTLVQAQGDWLFRTQEDLRTEFDTTPSGYKRMQQLHDAFKAKGVELVVVYQPTRGLVNRNKLNPEEKAKFDFDKALGNYKTMLGRFAKMGYVVPDLSPLTNEQLPDELPAHDFYFRGDQHWTPYGAQRTAKIVAAKVKQMPEYAEIPKREFETKRSGRMGKTGTLHNMAGQLCGTSYAIQYMDQFTTEPKGEAGDGDLFSDSGNPQITLVGTSHSGKNYNFAGFLEEEIGADILNVAFPGGGLEGSMIQYLGSDEFQKSPPKILIWEFSPLYRLDQETIYRQMMALLDNGCEGKTAQMSASTTLKPGKNELLVNSSNKDLRNANHQVDIRFADPSVKTLQATLWYMNGRHEDIKIEKPETSDTDGRFAFELRTDEDWASQNLLAVEVQGPEAGAAAQKVEAKICTRNVFPAGGQQTAAAGQ

53.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make algX using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here