About Products Protein Database Contact

Protein expression services for algF | Alginate biosynthesis protein AlgF

Description
Together with AlgI and AlgJ, forms an inner membrane complex which probably interacts with the alginate polymerization-transport complex and adds acetyl groups at the O-2 and O-3 positions of mannuronate residues. Acetylation of alginate is important for the architecture of biofilms and increases the ability of alginate to act as a defense barrier (By similarity).
Family
Belongs to the AlgF family.
Species
Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)
Length
215 amino acids
Sequence
MTTKTSIAKALTLAAGLSLASMQAFAGADAALYGPSAPKGSTFVRLYNATSAPAAASVGNTQIKQVGAQASSDFSFLPGGDYTAQVGGKSVPVKLASDKYYTLVNSNSGSPKLIEEPPFKNKQKALVRVQNLSDQQLTLKTADGKTEVVKPVAANGRGEREINPVKVNLALYQGDKKVGDVKPVALERGEAAVLYVTGSGNALSPVWVTRPVASN
Mass
22.3 kDa
Simulated SDS-PAGE
Western blot of algF recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make algF using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here