Together with AlgI and AlgJ, forms an inner membrane complex which probably interacts with the alginate polymerization-transport complex and adds acetyl groups at the O-2 and O-3 positions of mannuronate residues. Acetylation of alginate increases cyst resistance to desiccation.

Belongs to the AlgF family.

217 amino acids

MTRLHRKHRIALGLGLGLLLGFGGTTVQAAGDAALYEAVAPKGSTFVRLYNASNQEVSANVGSINLEDVSPLSSSGFEYLPAGQYSARVGSQNLPVNLSAEHYYTLVTQSGAAPLLVEEPAFKSKQKALLRVQNLSDKPLTLKTADGKTEVVKSVEPKGRGDREINPVKANLALFDGERKVADLKPISLARGEVVCLYVTGTANQLNPVWVKPPVKE

23.2 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make algF using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here