About Products Protein Database Contact

Protein expression services for Akr1d1 | Aldo-keto reductase family 1 member D1

Description
Catalyzes the stereospecific NADPH-dependent reduction of the C4-C5 double bond of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure to yield an A/B cis-ring junction. This cis-configuration is crucial for bile acid biosynthesis and plays important roles in steroid metabolism. Capable of reducing a broad range of delta-(4)-3-ketosteroids from C18 (such as, 17beta-hydroxyestr-4-en-3-one) to C27 (such as, 7alpha-hydroxycholest-4-en-3-one).
Family
Belongs to the aldo/keto reductase family.
Species
Mus musculus
Length
325 amino acids
Sequence
MNLSAAHHQISLSDGNNIPLIGLGTYSDPRPVPGKTYVAVKTAIDEGYRHIDGAYVYHNEHEVGEAIREKIAEGKVKREEIFYCGKLWNTEHVPSMVLPALERTLKALKLDYIDLYIIELPMAFKPGKEIYPRDENGRIIYDKTNLCATWEALEACKDAGLVKSLGVSNFNRRQLELILNKPGLKYKPVTNQVECHPYFTQTKLLKFCQQHDIVIVAHSPLGTCRNPSWVNVSSPPLLNDELLTSLGKKYNKTQAQIVLRFNIQRGIVVIPKSFTPERIKENFQIFDFSLTEEEMKDIDALNKNVRYVELLMWSDHPEYPFHDEY
Mass
37.3 kDa
Simulated SDS-PAGE
Western blot of Akr1d1 recombinant protein(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make Akr1d1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here