Catalyzes the stereospecific NADPH-dependent reduction of the C4-C5 double bond of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure to yield an A/B cis-ring junction. This cis-configuration is crucial for bile acid biosynthesis and plays important roles in steroid metabolism. Capable of reducing a broad range of delta-(4)-3-ketosteroids from C18 (such as, 17beta-hydroxyestr-4-en-3-one) to C27 (such as, 7alpha-hydroxycholest-4-en-3-one).

Belongs to the aldo/keto reductase family.

325 amino acids

MNLSAAHHQISLSDGNNIPLIGLGTYSDPRPVPGKTYVAVKTAIDEGYRHIDGAYVYHNEHEVGEAIREKIAEGKVKREEIFYCGKLWNTEHVPSMVLPALERTLKALKLDYIDLYIIELPMAFKPGKEIYPRDENGRIIYDKTNLCATWEALEACKDAGLVKSLGVSNFNRRQLELILNKPGLKYKPVTNQVECHPYFTQTKLLKFCQQHDIVIVAHSPLGTCRNPSWVNVSSPPLLNDELLTSLGKKYNKTQAQIVLRFNIQRGIVVIPKSFTPERIKENFQIFDFSLTEEEMKDIDALNKNVRYVELLMWSDHPEYPFHDEY

37.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Akr1d1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here