Protein expression services for AKR1C13 | Aldo-keto reductase family 1 member C13
Description
Catalyzes the dehydrogenation of morphine to morphinone. The enzyme also exhibits significant activity for a variety of cyclic and alicyclic alcohols. In addition to xenobiotics, the enzyme catalyzes the dehydrogenation of 17-beta-hydroxysteroids with much higher affinities than morphine. Uses both NAD and NADP, but the activity is much greater with NAD than with NADP.
Family
Belongs to the aldo/keto reductase family.
Species
Mesocricetus auratus
Length
322 amino acids
Sequence
XXXXXXXXXXXDGHCIPALGFGTYKPIEVPKSKAMEAANLAIGVGYRHIDTAYAYQIEEEIGQAIQSNIKAGIVKREDMFITTKLWCTCFQPELVRPSLEKXXXKLQLEHVDLFIMHYPVPMKAGDNDFPLDEQGKLLLDTVDFCATWEALEKXXDAGLVKSIGVSNFNMRQLERILNKPGLKYKPVCNQVECHVYNNQSKLLDYCKSKDIVLVAFGALGTQRYKEWVDQDSPVLLNDPVLCGGAKXXXRSPALIALRYLVQRGVVPLAQSFYESEMKENLQVFEFQLSPEDMKILDGLNKNFRYLPAQFFADHPEYPFSEE
Mass
36.5 kDa
Simulated SDS-PAGE
(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service
Make AKR1C13 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)
Order Here