Catalyzes the NADPH-dependent reduction of a wide variety of carbonyl-containing compounds to their corresponding alcohols. Displays enzymatic activity towards endogenous metabolites such as aromatic and aliphatic aldehydes, ketones, monosaccharides and bile acids. Acts as an aldehyde-detoxification enzyme (By similarity). Displays no reductase activity towards retinoids (By similarity).

Belongs to the aldo/keto reductase family.

327 amino acids

MATSVEYETLYTGQKMPLIGLGTWKSAPGQVKDAVKYALGVGYRHIDCAFVYGNETEVGEAIKESVGPDKGLKREEVFVTSKLWNNKHHPDDVECALRKTLQELQLDYLDLYLMHWPYAFKRGDQVFPQNPDGSVQYDLTDYKDTWKAMEKLVEKGLAKAIGLSNFNKRQMDDILSIATVKPAVLQVECHPYLAQNELIACCRSHGLVLTGYSPLGSPDRSWRKPEDPVLLEEPGIIAMAKKYNISEAQILLRWQVQRRVVTIPKSVTPARILQNLQVFDFSLSEEEMQLIGALNKNWRYIIPLITVNGKSVPRDAGHPLYPFNDPY

37.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make akr1a1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here