Multifunctional alcohol dehydrogenase exhibiting NAD(+)-dependent dehydrogenase activities for 2,3-butanediol, ethanol and acetaldehyde, and reductase activities for acetoin (NADH-dependent), and diacetyl and acetaldehyde (independently of whether NADH or NADPH is the reductant). The rate of oxidation of 2,3-butanediol is much higher than for the oxidation of ethanol. Has acetaldehyde dehydrogenase activity leading to acetate formation. May function in the release of excess reducing power in the absence of exogenous hydrogen acceptors such as oxygen.

Belongs to the zinc-containing alcohol dehydrogenase family.

366 amino acids

MTAMMKAAVFVEPGRIELADKPIPDIGPNDALVRITTTTICGTDVHILKGEYPVAKGLTVGHEPVGIIEKLGSAVTGYREGQRVIAGAICPNFNSYAAQDGVASQDGSYLMASGQCGCHGYKATAGWRFGNMIDGTQAEYVLVPDAQANLTPIPDGLTDEQVLMCPDIMSTGFKGAENANIRIGDTVAVFAQGPIGLCATAGARLCGATTIIAIDGNDHRLEIARKMGADVVLNFRNCDVVDEVMKLTGGRGVDASIEALGTQATFEQSLRVLKPGGTLSSLGVYSSDLTIPLSAFAAGLGDHKINTALCPGGKERMRRLINVIESGRVDLGALVTHQYRLDDIVAAYDLFANQRDGVLKIAIKPH

38.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make adh using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here