Catalyzes the interconversion of L-alanine and D-alanine. Likely plays an important role in supplying D-alanine, which is an indispensable constituent in the biosynthesis of bacterial cell-wall peptidoglycan. To a lesser extent, is also able to racemize L-serine and D-serine. Does not act on other proteinogenic amino-acids.

Belongs to the alanine racemase family.

361 amino acids

MKAATAYINLEALQHNLQRVKQQAPESKIMAVVKANGYGHGLRHIARHALGADAFGVARIEEALQLRASGVVKPILLLEGFYSPGDLPVLVTNNIQTVVHCEEQLQALEQAQLETPVMVWLKVDSGMHRLGVRPEQYQDFVARLHQCENVAKPLRYMSHFGCADELDKSTTVEQTELFLSLTQGCQGERSLAASAGLLAWPQSQLEWVRPGIIMYGVSPFVEKSAVQLGYQPVMTLKSHLIAVREVKAGESVGYGGTWTSQRDTKIGVIAIGYGDGYPRTAPNGTPVVVNGRRVPIAGRVSMDMLTVDLGPDACDRVGDEAMLWGNELPVEEVAAHIGTIGYELVTKLTSRVEMSYYGAGV

39.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make alr1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here