Catalyzes the reversible reductive amination of pyruvate to L-alanine. This enzyme is a key factor in the assimilation of L-alanine as an energy source through the tricarboxylic acid cycle during sporulation (By similarity).

Belongs to the AlaDH/PNT family.

376 amino acids

MIIGVPKEIKNNENRVAMTPAGVVHLINAGHTVQIEKGAGLGSNFADAEYKEAGAELIDSAASVWENADMIMKVKEPLSSEYKYFRKGLILFTYLHLAAAPELTKALVDSEVTAIAYETITVNGTLPLLTPMSEVAGRMATQIGAQYLEKSEGGKGILLGGIPGVSRGKVTVIGGGVVGTHAAKIALGLGAEVTIIDLNPVRLRQLDDIFGSSIQTLMSNPYNIAEAVKDSDLVIGSVLIPGRKAPKLVTDEMIQSMQPGSVLVDVAIDQGGNFETVDHPTTHDEPIYVKHDVLHYAVANIPGAVPRTATVGLTNVTVPYAVQIASKGAVKAIQDNPAILTGVNVMNGKVTYEAVAADLGYDFVSPEDAIKDAELV

39.6 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ald using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here