Component of the shelterin complex (telosome) that is involved in the regulation of telomere length and protection. Shelterin associates with arrays of double-stranded TTAGGG repeats added by telomerase and protects chromosome ends. Without its protective activity, telomeres are no longer hidden from the DNA damage surveillance and chromosome ends are inappropriately processed by DNA repair pathways. Promotes binding of POT1 to single-stranded telomeric DNA. Modulates the inhibitory effects of POT1 on telomere elongation. The ACD-POT1 heterodimer enhances telomere elongation by recruiting telomerase to telomeres and increasing its processivity (By similarity). May play a role in organogenesis (PubMed:15537664).

416 amino acids

MSDSGLLALQPWIRELILGSETLSSPRTGQLLKVLQDSETPGPSSAPDTPDTGAVLLVSDGTHSVRCVVTRNAIDTSDWEEKELGFRGTEGRLLLLQACGLRVQVAQDHAPAEFYLQVDRFNLLPTEQPRIQVTGCNQDSDVQRKLNECLEDHLSESASSSAGLTLSQLLDEVREDQDHRGALVCLAKSCLVLKGPCTTTPLTDWITSGSQALGKAVFTVSGSLLHIPEGEEQILSSTGSSQKARGTSASPSHMPLEESGASVSLLSALATSDPGQMDSSQSPPAVGSTSPRAQAPTSPPCNSTPSSLLLNCSPSLSPLHPAPRSHQSCETRAQAPKLEFQCSFKKRQLLPRTSAQELCSVWEPPERHRDTSAFQYKYETPSASLHTQVQTARLSPQLVAWALNIVMESESELTQV

44.7 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Acd using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here