Directly regulates filament dynamics and has been implicated in a number of complex developmental and morphological processes, including mRNA localization and the establishment of cell polarity.

Belongs to the CAP family.

multiple

233 amino acids

LEAVSHASDTHYGYGDSAAKEIGGDVLKHAEMVHTGLKEYKDVDKXGPVAKELSGLPSGPSAGSGPPPSALFAQIHQGESITHALKHVADDEKTHKNPADKAQSGPVRXGPKPFSASKPGISPSPKPVTKKWRXENXENVSNLVIDDTELKSVNSTLQIKXXINSISVDNYKVPXISINKXDGRHIYLSKNSLDCEIVSAKSSEMNVLIPTEGGDFNEFPVPEQXKXIWNGQK

25.1 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make CAP1 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here