Plays an important role in the de novo pathway of purine nucleotide biosynthesis. Catalyzes the first committed step in the biosynthesis of AMP from IMP.

Belongs to the adenylosuccinate synthetase family.

432 amino acids

MPNVVVVGAQWGDEGKGRVVDWLAAQADLVARYNGGHNAGHTLVVGGKTYKLALLPSGVVRGKRGVIGNGVALDPEALLAEIGRMAELGLSVTPDNLSIAENATLVLPIHRAIDQAQERLRREPIGTTLRGIGPAYEDKVGRRGLRVGDLAEPGRLAAKLDVLVDHHNAWFRGLGLDEYSRDAMLATLVDLAPRILPFVRPVWADLNDATDRGERILFEGSQAVMLDIDWGTYPFVTSSGTVASAAAAGTGLGASKLGHVLGVTKAYATRVGGGPFLTELSDATGETLRARGQEFGVNTGRPRRCGWLDAAQLRQAVRISGIDSLALTKLDVLDGFESIELCVGYEFDGARVDHLPASLDAQSRAKPVYERFDGWRGTVKGVRERAALPRAAQDFIARVEAVAGAPVSMITTGAERDDTIVLRNPFDAAAGA

45.9 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make purA2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here