Description
Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism. Adenylate kinase activity is critical for regulation of the phosphate utilization and the AMP de novo biosynthesis pathways.
Family
Belongs to the adenylate kinase family. AK2 subfamily.
Sequence
MAPNAAAVAPKPEQEQATGINAILLGPPGSGKGTQAPLLKEKFCVCHLSTGDMLRAEIAAGSKLGAQLKKVMDEGKLVSDDLVVDMIDSNLDKPECKNGFLLDGFPRTVVQAEKLDDLLEKRKTGLDAVVEFGIDDSLLVRRITGRLIHQASGRSYHEEFAPPKVAMTDDVTGEPLMRRSDDNAAALVKRLEAYHKQTKPLADYYALRGLHFRVDAAQSASRVFENIDSIFTSQRKARMGL
Simulated SDS-PAGE

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)
Safety
Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.
Protein synthesis service