Nucleoside monophosphate (NMP) kinase that catalyzes the reversible transfer of the terminal phosphate group between nucleoside triphosphates and monophosphates. Active on AMP and dAMP with ATP as a donor. When GTP is used as phosphate donor, the enzyme phosphorylates AMP, CMP, and to a small extent dCMP. Also displays broad nucleoside diphosphate kinase activity.

Belongs to the adenylate kinase family.

562 amino acids

MNTNEAKEYLARREIPQLFESLLNGLMCSKPEDPVEYLESCLQKVKELGGCDKVKWDTFVSQEKKTLPPLNGGQSRRSFLRNVMPENSNFPYRRYDRLPPIHQFSIESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQSLKIAERYGFQYISVGELLRKKIHSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQMPDEVGIVIDGFPRDVAQALSFEDQICTPDLVVFLACTNQRLKERLLKRAEQQGRPDDNLKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVDSKLFPNKEAAAGSSDLDPSMMLDTGEVIDTGSDYEDQGDDQLNVFGEDTMGGFMEDLKKCKIIFMIGGPGSGKGTQCGKLAEKYGFTHLSTDELLQNELSSESGRSKLIRDIMERGELVPSGIILELLKEAMVASLSNTKGFLIDGYPREVKQGEEFGRRIGDPHLVICMDCSADTMTNRLLQRSRNSPQADDNTTTIAKRLETYYRASIPVVAYYETKTQLHKINAEGTPEEVFLQLCTAIDSIF

63.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make Ak5 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here