Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism.

Belongs to the adenylate kinase family.

248 amino acids

MATSSAASVDMEDIQTVDLMSELLRRMKCASKPDKRLVFIGPPGSGKGTQSPVIKDEFCLCHLSTGDMLRAAVAAKTPLGVKAKEAMDKGELVSDDLVVGIMDEAMNRPKCQKGFILDGFPRTVTQAEKLDEMLNRRGAQIDKVLNFAIDDSVLEERITGRWIHPSSGRSYHTKFAPPKVPGVDDLTGEPLIQRKDDNADVLRSRLDAFHKQTQPVIDYYAKKENLVNIPAEKAPEEVTKVVKKVVST

27.3 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make ADK2 using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here