In vitro, CyaB catalyzes the biosynthesis of cyclic AMP (cAMP) from ATP. It seems that under the physiological conditions CyaB has no function in cAMP processes. In vitro, it is also able to hydrolyze substrates such as thiamine triphosphate (ThTP) and inorganic triphosphate (PPPi) at a low rate. It has a slight preference for ThTP over ATP and PPPi in the presence of manganese ions. This PPPase activity is probably not of physiological importance.

Belongs to the adenylyl cyclase CyaB family.

191 amino acids

MSSQHFQGRFEVEFKYRLSDVDAFTCALAALNPEVMLEDNQEQDSYFDTPEHSLAAEGKSLVIRTMQPSGIQLWIVKGPEADRCEAVNITDADKAASMLRTLGYRQVLAISKRRSIYFVGPFHVTRDHLEGIGDFAELAIMTDDEALLPDYRQQLQDLATRLGLSSAQLETRSYRTLCEQSLTLNSEKVPS

21.5 kDa

(Note: Representative image - actual molecular weight may vary depending on tag type and expression method)

Upon ordering, we will perform rigorous biosecurity and export control screening to ensure that order fulfillment is consistent with all legal and regulatory guidance.

Make cyaB using our protein expression services starting at $99 + $.30/amino acid in as fast as two weeks (includes the cost of DNA synthesis)

Order Here